SCOPe 2.08: Domain d3cw2h3: 3cw2 H:176-266

Lineage for d3cw2h3 (3cw2 H:176-266)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family)

5. Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)

6. Protein eIF-2-alpha, C-terminal domain [110995] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
   Uniprot Q97Z79 176-264

8. Domain d3cw2h3: 3cw2 H:176-266 [208968]
   Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c1, d3cw2c2, d3cw2d1, d3cw2d2, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g1, d3cw2g2, d3cw2h1, d3cw2h2
   automated match to d2ahob3

Details for d3cw2h3

PDB Entry: 3cw2, 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .

PDB Compounds: (H:) Translation initiation factor 2 subunit alpha

SCOPe Domain Sequences for d3cw2h3:

Sequence; same for both SEQRES and ATOM records:

>d3cw2h3 d.58.51.1 (H:176-266) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvvkk

Timeline for d3cw2h3:

• d3cw2h3 first appeared in SCOPe 2.03
  
• d3cw2h3 appears in SCOPe 2.07