Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
Protein automated matches [254469] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries) |
Domain d2zite5: 2zit E:726-842 [239078] Other proteins in same PDB: d2zita1, d2zita2, d2zita4, d2zitb2, d2zitb3, d2zitc1, d2zitc2, d2zitc4, d2zitd2, d2zitd3, d2zite1, d2zite2, d2zite4, d2zitf2, d2zitf3 automated match to d1n0ua5 protein/RNA complex; complexed with nad |
PDB Entry: 2zit (more details), 3 Å
SCOPe Domain Sequences for d2zite5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zite5 d.58.11.0 (E:726-842) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d2zite5:
View in 3D Domains from same chain: (mouse over for more information) d2zite1, d2zite2, d2zite3, d2zite4 |