![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255013] (5 PDB entries) |
![]() | Domain d2zitc4: 2zit C:561-725 [239072] Other proteins in same PDB: d2zita1, d2zita2, d2zita3, d2zita5, d2zitb2, d2zitb3, d2zitc1, d2zitc2, d2zitc3, d2zitc5, d2zitd2, d2zitd3, d2zite1, d2zite2, d2zite3, d2zite5, d2zitf2, d2zitf3 automated match to d1n0ua3 protein/RNA complex; complexed with nad |
PDB Entry: 2zit (more details), 3 Å
SCOPe Domain Sequences for d2zitc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zitc4 d.14.1.0 (C:561-725) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d2zitc4:
![]() Domains from same chain: (mouse over for more information) d2zitc1, d2zitc2, d2zitc3, d2zitc5 |