Lineage for d2zite1 (2zit E:2-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111132Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)
  8. 2111138Domain d2zite1: 2zit E:2-343 [239074]
    Other proteins in same PDB: d2zita2, d2zita3, d2zita4, d2zita5, d2zitb2, d2zitb3, d2zitc2, d2zitc3, d2zitc4, d2zitc5, d2zitd2, d2zitd3, d2zite2, d2zite3, d2zite4, d2zite5, d2zitf2, d2zitf3
    automated match to d1n0ua2
    protein/RNA complex; complexed with nad

Details for d2zite1

PDB Entry: 2zit (more details), 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d2zite1:

Sequence, based on SEQRES records: (download)

>d2zite1 c.37.1.8 (E:2-343) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk
deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv
tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart
vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm
drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle
kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d2zite1 c.37.1.8 (E:2-343) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
lkvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d2zite1:

Click to download the PDB-style file with coordinates for d2zite1.
(The format of our PDB-style files is described here.)

Timeline for d2zite1: