Lineage for d2zitd2 (2zit D:400-605)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208076Family d.166.1.1: ADP-ribosylating toxins [56400] (10 protein domains)
  6. 2208162Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 2208163Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 2208180Domain d2zitd2: 2zit D:400-605 [154482]
    Other proteins in same PDB: d2zita1, d2zita2, d2zita3, d2zita4, d2zita5, d2zitb3, d2zitc1, d2zitc2, d2zitc3, d2zitc4, d2zitc5, d2zitd3, d2zite1, d2zite2, d2zite3, d2zite4, d2zite5, d2zitf3
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d2zitd2

PDB Entry: 2zit (more details), 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex
PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d2zitd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zitd2 d.166.1.1 (D:400-605) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
qdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltla
apeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvg
gdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d2zitd2:

Click to download the PDB-style file with coordinates for d2zitd2.
(The format of our PDB-style files is described here.)

Timeline for d2zitd2: