SCOPe 2.07: Domain d2zite5: 2zit E:726-842

Lineage for d2zite5 (2zit E:726-842)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.0: automated matches [254210] (1 protein)
   not a true family

6. Protein automated matches [254469] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries)

8. Domain d2zite5: 2zit E:726-842 [239078]
   Other proteins in same PDB: d2zita1, d2zita2, d2zita4, d2zitb2, d2zitb3, d2zitc1, d2zitc2, d2zitc4, d2zitd2, d2zitd3, d2zite1, d2zite2, d2zite4, d2zitf2, d2zitf3
   automated match to d1n0ua5
   protein/RNA complex; complexed with nad

Details for d2zite5

PDB Entry: 2zit, 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex

PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d2zite5:

Sequence; same for both SEQRES and ATOM records:

>d2zite5 d.58.11.0 (E:726-842) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Timeline for d2zite5:

• d2zite5 first appeared in SCOPe 2.04
  
• d2zite5 appears in SCOPe 2.06
  
• d2zite5 appears in the current release, SCOPe 2.08