![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (3 PDB entries) |
![]() | Domain d2nqbh_: 2nqb H: [238765] Other proteins in same PDB: d2nqba_, d2nqbb_, d2nqbe_, d2nqbf_ automated match to d3mgpd_ protein/DNA complex |
PDB Entry: 2nqb (more details), 2.3 Å
SCOPe Domain Sequences for d2nqbh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqbh_ a.22.1.1 (H:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} krkesyaiyiytvlkqvhpdtgisskamsimnsfvndiferiaaeasrlahynkrstits reiqtavrlllpgelakhavsegtkavtkytss
Timeline for d2nqbh_: