PDB entry 2nqb

View 2nqb on RCSB PDB site
Description: Drosophila Nucleosome Structure
Class: structural protein/DNA
Keywords: Nucleosome, NCP, chromatin, histone, STRUCTURAL PROTEIN/DNA COMPLEX
Deposited on 2006-10-30, released 2007-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqba_
  • Chain 'B':
    Compound: histone h4
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqbb_
  • Chain 'C':
    Compound: histone h2a
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqbc_
  • Chain 'D':
    Compound: histone h2b
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02283
      • engineered (40)
    Domains in SCOPe 2.07: d2nqbd_
  • Chain 'E':
    Compound: histone h3
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqbe_
  • Chain 'F':
    Compound: histone h4
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqbf_
  • Chain 'G':
    Compound: histone h2a
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqbg_
  • Chain 'H':
    Compound: histone h2b
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02283
      • engineered (40)
    Domains in SCOPe 2.07: d2nqbh_
  • Chain 'I':
    Compound: alpha-satellite DNA
    Species: Homo sapiens [TaxId:9606]
    Gene: His3
  • Chain 'J':
    Compound: alpha-satellite DNA
    Species: Homo sapiens [TaxId:9606]
    Gene: His3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nqbA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nqbB (B:)
    itgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbB (B:)
    lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
    tamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nqbC (C:)
    sgrgkggkvkgkaksrsnraglqfpvgrihrllrkgnyaervgagapvylaavmeylaae
    vlelagnaardnkktriiprhlqlairndeelnkllsgvtiaqggvlpniqavllpkkte
    kka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbC (C:)
    aksrsnraglqfpvgrihrllrkgnyaervgagapvylaavmeylaaevlelagnaardn
    kktriiprhlqlairndeelnkllsgvtiaqggvlpniqavllpkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nqbD (D:)
    ippktsgkaakkagkaqknitktdkkkkrkrkesyaiyiytvlkqvhpdtgisskamsim
    nsfvndiferiaaeasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyt
    ssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbD (D:)
    rkrkesyaiyiytvlkqvhpdtgisskamsimnsfvndiferiaaeasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2nqbE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbE (E:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2nqbF (F:)
    itgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbF (F:)
    rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
    krktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2nqbG (G:)
    sgrgkggkvkgkaksrsnraglqfpvgrihrllrkgnyaervgagapvylaavmeylaae
    vlelagnaardnkktriiprhlqlairndeelnkllsgvtiaqggvlpniqavllpkkte
    kka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbG (G:)
    aksrsnraglqfpvgrihrllrkgnyaervgagapvylaavmeylaaevlelagnaardn
    kktriiprhlqlairndeelnkllsgvtiaqggvlpniqavllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2nqbH (H:)
    ippktsgkaakkagkaqknitktdkkkkrkrkesyaiyiytvlkqvhpdtgisskamsim
    nsfvndiferiaaeasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyt
    ssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqbH (H:)
    krkesyaiyiytvlkqvhpdtgisskamsimnsfvndiferiaaeasrlahynkrstits
    reiqtavrlllpgelakhavsegtkavtkytss
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.