| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158387] (2 PDB entries) |
| Domain d2nqbe_: 2nqb E: [148342] Other proteins in same PDB: d2nqbc_, d2nqbd_, d2nqbg_, d2nqbh_ automated match to d1kx5a_ protein/DNA complex |
PDB Entry: 2nqb (more details), 2.3 Å
SCOPe Domain Sequences for d2nqbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqbe_ a.22.1.1 (E:) Histone H4 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d2nqbe_: