Lineage for d2nqba_ (2nqb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698549Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158387] (2 PDB entries)
  8. 2698550Domain d2nqba_: 2nqb A: [148340]
    Other proteins in same PDB: d2nqbc_, d2nqbd_, d2nqbg_, d2nqbh_
    automated match to d1kx5a_
    protein/DNA complex

Details for d2nqba_

PDB Entry: 2nqb (more details), 2.3 Å

PDB Description: drosophila nucleosome structure
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d2nqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqba_ a.22.1.1 (A:) Histone H4 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d2nqba_:

Click to download the PDB-style file with coordinates for d2nqba_.
(The format of our PDB-style files is described here.)

Timeline for d2nqba_: