SCOPe 2.08: Domain d3rfza1: 3rfz A:1-158

Lineage for d3rfza1 (3rfz A:1-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)

8. Domain d3rfza1: 3rfz A:1-158 [233447]
   Other proteins in same PDB: d3rfzc1, d3rfzc2, d3rfzf1, d3rfzf2
   automated match to d4av5a_
   complexed with so4

Details for d3rfza1

PDB Entry: 3rfz, 2.8 Å

PDB Description: Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate

PDB Compounds: (A:) Type 1 fimbrial adhesin

SCOPe Domain Sequences for d3rfza1:

Sequence; same for both SEQRES and ATOM records:

>d3rfza1 b.2.3.2 (A:1-158) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d3rfza1:

• d3rfza1 first appeared in SCOPe 2.03
  
• d3rfza1 appears in SCOPe 2.07