Lineage for d3rfza1 (3rfz A:1-158)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300809Protein automated matches [190569] (7 species)
    not a true protein
  7. 1300817Species Escherichia coli [TaxId:562] [188033] (4 PDB entries)
  8. 1300824Domain d3rfza1: 3rfz A:1-158 [233447]
    Other proteins in same PDB: d3rfzc1, d3rfzc2, d3rfzf1, d3rfzf2
    automated match to d4av5a_
    complexed with so4

Details for d3rfza1

PDB Entry: 3rfz (more details), 2.8 Å

PDB Description: Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate
PDB Compounds: (A:) Type 1 fimbrial adhesin

SCOPe Domain Sequences for d3rfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rfza1 b.2.3.2 (A:1-158) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d3rfza1:

Click to download the PDB-style file with coordinates for d3rfza1.
(The format of our PDB-style files is described here.)

Timeline for d3rfza1:

1300824
d3rfza1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3rfza2