SCOPe 2.08: Domain d3rfzd2: 3rfz D:159-279

Lineage for d3rfzd2 (3rfz D:159-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)

8. Domain d3rfzd2: 3rfz D:159-279 [239694]
   Other proteins in same PDB: d3rfzc1, d3rfzc2, d3rfzf1, d3rfzf2
   automated match to d3rfza2
   complexed with so4

Details for d3rfzd2

PDB Entry: 3rfz, 2.8 Å

PDB Description: Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate

PDB Compounds: (D:) Type 1 fimbrial adhesin

SCOPe Domain Sequences for d3rfzd2:

Sequence; same for both SEQRES and ATOM records:

>d3rfzd2 b.2.3.2 (D:159-279) automated matches {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdyrgsvpipltvycaksqnlgyylsgthadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d3rfzd2:

• d3rfzd2 first appeared in SCOPe 2.04
  
• d3rfzd2 appears in SCOPe 2.07