![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) ![]() |
![]() | Family b.7.2.0: automated matches [227280] (1 protein) not a true family |
![]() | Protein automated matches [227091] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [226556] (2 PDB entries) |
![]() | Domain d3rfzf2: 3rfz F:121-205 [215794] Other proteins in same PDB: d3rfza1, d3rfza2, d3rfzc1, d3rfzd1, d3rfzd2, d3rfzf1 automated match to d1l4ia2 complexed with so4 |
PDB Entry: 3rfz (more details), 2.8 Å
SCOPe Domain Sequences for d3rfzf2:
Sequence, based on SEQRES records: (download)
>d3rfzf2 b.7.2.0 (F:121-205) automated matches {Escherichia coli [TaxId: 562]} alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd agsnityrtindygaltpkmtgvme
>d3rfzf2 b.7.2.0 (F:121-205) automated matches {Escherichia coli [TaxId: 562]} alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsn ityrtindygaltpkmtgvme
Timeline for d3rfzf2: