Lineage for d3rfzf2 (3rfz F:121-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773237Family b.7.2.0: automated matches [227280] (1 protein)
    not a true family
  6. 2773238Protein automated matches [227091] (2 species)
    not a true protein
  7. 2773239Species Escherichia coli [TaxId:562] [226556] (2 PDB entries)
  8. 2773249Domain d3rfzf2: 3rfz F:121-205 [215794]
    Other proteins in same PDB: d3rfza1, d3rfza2, d3rfzc1, d3rfzd1, d3rfzd2, d3rfzf1
    automated match to d1l4ia2
    complexed with so4

Details for d3rfzf2

PDB Entry: 3rfz (more details), 2.8 Å

PDB Description: Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate
PDB Compounds: (F:) chaperone protein fimc

SCOPe Domain Sequences for d3rfzf2:

Sequence, based on SEQRES records: (download)

>d3rfzf2 b.7.2.0 (F:121-205) automated matches {Escherichia coli [TaxId: 562]}
alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
agsnityrtindygaltpkmtgvme

Sequence, based on observed residues (ATOM records): (download)

>d3rfzf2 b.7.2.0 (F:121-205) automated matches {Escherichia coli [TaxId: 562]}
alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsn
ityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d3rfzf2:

Click to download the PDB-style file with coordinates for d3rfzf2.
(The format of our PDB-style files is described here.)

Timeline for d3rfzf2: