| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
| Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species) protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
| Species Escherichia coli [TaxId:562] [419300] (24 PDB entries) |
| Domain d4av5a_: 4av5 A: [192303] automated match to d1uwfa1 complexed with fyz, so4 |
PDB Entry: 4av5 (more details), 1.4 Å
SCOPe Domain Sequences for d4av5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4av5a_ b.2.3.2 (A:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d4av5a_: