SCOPe 2.07: Domain d4av5a_: 4av5 A:

Lineage for d4av5a_ (4av5 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (25 PDB entries)

8. Domain d4av5a_: 4av5 A: [192303]
   automated match to d1uwfa1
   complexed with fyz, so4

Details for d4av5a_

PDB Entry: 4av5, 1.4 Å

PDB Description: Structure of a triclinic crystal of the FimH lectin domain in complex with a propynyl biphenyl alpha-D-mannoside, at 1.4 A resolution

PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d4av5a_:

Sequence; same for both SEQRES and ATOM records:

>d4av5a_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4av5a_:

• d4av5a_ first appeared in SCOPe 2.02
  
• d4av5a_ appears in SCOPe 2.06
  
• d4av5a_ appears in the current release, SCOPe 2.08