SCOPe 2.08: Domain d3rfzf1: 3rfz F:1-120

Lineage for d3rfzf1 (3rfz F:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein automated matches [227064] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226144] (1 PDB entry)

8. Domain d3rfzf1: 3rfz F:1-120 [215793]
   Other proteins in same PDB: d3rfza1, d3rfza2, d3rfzc2, d3rfzd1, d3rfzd2, d3rfzf2
   automated match to d1l4ia1
   complexed with so4

Details for d3rfzf1

PDB Entry: 3rfz, 2.8 Å

PDB Description: Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate

PDB Compounds: (F:) chaperone protein fimc

SCOPe Domain Sequences for d3rfzf1:

Sequence; same for both SEQRES and ATOM records:

>d3rfzf1 b.1.11.1 (F:1-120) automated matches {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl

Timeline for d3rfzf1:

• d3rfzf1 first appeared in SCOPe 2.03
  
• d3rfzf1 appears in SCOPe 2.07