Lineage for d3h4ej1 (3h4e J:1-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2718011Protein automated matches [190369] (8 species)
    not a true protein
  7. 2718027Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232370] (2 PDB entries)
  8. 2718038Domain d3h4ej1: 3h4e J:1-147 [232383]
    Other proteins in same PDB: d3h4ea2, d3h4eb2, d3h4ec2, d3h4ed2, d3h4ee2, d3h4ef2, d3h4eg2, d3h4eh2, d3h4ei2, d3h4ej2, d3h4ek2, d3h4el2
    automated match to d1e6jp2

Details for d3h4ej1

PDB Entry: 3h4e (more details), 2.7 Å

PDB Description: x-ray structure of hexameric hiv-1 ca
PDB Compounds: (J:) capsid protein p24

SCOPe Domain Sequences for d3h4ej1:

Sequence, based on SEQRES records: (download)

>d3h4ej1 a.73.1.1 (J:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d3h4ej1 a.73.1.1 (J:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhpgqmreprgsdiagttstlqeqigwmthnppip
vgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d3h4ej1:

Click to download the PDB-style file with coordinates for d3h4ej1.
(The format of our PDB-style files is described here.)

Timeline for d3h4ej1: