Lineage for d3h4ek1 (3h4e K:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000764Protein automated matches [190369] (6 species)
    not a true protein
  7. 2000780Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232370] (2 PDB entries)
  8. 2000792Domain d3h4ek1: 3h4e K:1-147 [239333]
    Other proteins in same PDB: d3h4ea2, d3h4eb2, d3h4ec2, d3h4ed2, d3h4ee2, d3h4ef2, d3h4eg2, d3h4eh2, d3h4ei2, d3h4ej2, d3h4ek2, d3h4el2
    automated match to d3h47a1

Details for d3h4ek1

PDB Entry: 3h4e (more details), 2.7 Å

PDB Description: X-ray Structure of Hexameric HIV-1 CA
PDB Compounds: (K:) capsid protein p24

SCOPe Domain Sequences for d3h4ek1:

Sequence, based on SEQRES records: (download)

>d3h4ek1 a.73.1.1 (K:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d3h4ek1 a.73.1.1 (K:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmysp

SCOPe Domain Coordinates for d3h4ek1:

Click to download the PDB-style file with coordinates for d3h4ek1.
(The format of our PDB-style files is described here.)

Timeline for d3h4ek1: