PDB entry 3h4e

View 3h4e on RCSB PDB site
Description: X-ray Structure of Hexameric HIV-1 CA
Class: viral protein
Keywords: capsid protein, hexamer, engineered disulfide bonds, VIRAL PROTEIN
Deposited on 2009-04-19, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4ea1, d3h4ea2
  • Chain 'B':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4eb1, d3h4eb2
  • Chain 'C':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4ec1, d3h4ec2
  • Chain 'D':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
    Domains in SCOPe 2.07: d3h4ed1, d3h4ed2
  • Chain 'E':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4ee1, d3h4ee2
  • Chain 'F':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4ef1, d3h4ef2
  • Chain 'G':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4eg1, d3h4eg2
  • Chain 'H':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
    Domains in SCOPe 2.07: d3h4eh1, d3h4eh2
  • Chain 'I':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4ei1, d3h4ei2
  • Chain 'J':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4ej1, d3h4ej2
  • Chain 'K':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
    Domains in SCOPe 2.07: d3h4ek1, d3h4ek2
  • Chain 'L':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: CA, gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (0-End)
      • engineered (13)
      • engineered (44)
      • engineered (183-184)
    Domains in SCOPe 2.07: d3h4el1, d3h4el2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h4eA (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eA (A:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    naatetllvqnanpdcktilkalgpgatleemmtacqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h4eB (B:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eB (B:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpgqmreprgsdiagttstlqeqigwmthnppipvge
    iykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraenaatetllvqnan
    pdcktilkalgpgatleemmtacq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h4eC (C:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eC (C:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvgqmreprgsdiagttstlqeqigwmthnppipvg
    eiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaate
    tllvqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h4eD (D:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eD (D:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpgqmreprgsdiagttstlqeqigwmthnppipvge
    iykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdck
    tilkalgpgatleemmtacq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3h4eE (E:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eE (E:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhreprgsdiagttstlqeqigwmthnppipvgeiykr
    wiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvq
    nanpdcktilkalgpgatleemmtacq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3h4eF (F:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eF (F:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3h4eG (G:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eG (G:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    naatetllvqnanpdcktilkalgpgatleemmtacqg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3h4eH (H:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eH (H:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtllv
    qnanpdcktilkalgpgatleemmtacq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3h4eI (I:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eI (I:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeaatet
    llvqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3h4eJ (J:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eJ (J:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhpgqmreprgsdiagttstlqeqigwmthnppip
    vgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaa
    tetllvqnanpdcktilkalgpgatleemmtacq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3h4eK (K:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eK (K:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdckti
    lkalgpgatleemmtacq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3h4eL (L:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknaatetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4eL (L:)
    pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhprgsdiagttstlqeqigwmthnppipvgeiykrwi
    ilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqna
    npdcktilkalgpgatleemmtacq