![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein automated matches [190369] (8 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232370] (2 PDB entries) |
![]() | Domain d3h4ef1: 3h4e F:1-147 [232380] Other proteins in same PDB: d3h4ea2, d3h4eb2, d3h4ec2, d3h4ed2, d3h4ee2, d3h4ef2, d3h4eg2, d3h4eh2, d3h4ei2, d3h4ej2, d3h4ek2, d3h4el2 automated match to d1e6jp2 |
PDB Entry: 3h4e (more details), 2.7 Å
SCOPe Domain Sequences for d3h4ef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h4ef1 a.73.1.1 (F:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]} pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
Timeline for d3h4ef1: