SCOPe 2.08: Domain d2jj7a1: 2jj7 A:3-76

Lineage for d2jj7a1 (2jj7 A:3-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein automated matches [230914] (1 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [230915] (2 PDB entries)

8. Domain d2jj7a1: 2jj7 A:3-76 [230937]
   Other proteins in same PDB: d2jj7a2, d2jj7b2
   automated match to d2fx0a1
   mutant

Details for d2jj7a1

PDB Entry: 2jj7, 2.1 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 170-185 substituted by alanine

PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jj7a1:

Sequence; same for both SEQRES and ATOM records:

>d2jj7a1 a.4.1.9 (A:3-76) automated matches {Bacillus cereus [TaxId: 1396]}
asreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkky
glanelpnfleknq

Timeline for d2jj7a1:

• d2jj7a1 first appeared in SCOPe 2.03
  
• d2jj7a1 appears in SCOPe 2.07