| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein automated matches [230914] (1 species) not a true protein |
| Species Bacillus cereus [TaxId:1396] [230915] (2 PDB entries) |
| Domain d2jj7b1: 2jj7 B:1-76 [230916] Other proteins in same PDB: d2jj7a2, d2jj7b2 automated match to d2fx0a1 mutant |
PDB Entry: 2jj7 (more details), 2.1 Å
SCOPe Domain Sequences for d2jj7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj7b1 a.4.1.9 (B:1-76) automated matches {Bacillus cereus [TaxId: 1396]}
hmasreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfk
kyglanelpnfleknq
Timeline for d2jj7b1: