Lineage for d2jj7b1 (2jj7 B:1-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692545Protein automated matches [230914] (1 species)
    not a true protein
  7. 2692546Species Bacillus cereus [TaxId:1396] [230915] (2 PDB entries)
  8. 2692550Domain d2jj7b1: 2jj7 B:1-76 [230916]
    Other proteins in same PDB: d2jj7a2, d2jj7b2
    automated match to d2fx0a1
    mutant

Details for d2jj7b1

PDB Entry: 2jj7 (more details), 2.1 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 170-185 substituted by alanine
PDB Compounds: (B:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jj7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj7b1 a.4.1.9 (B:1-76) automated matches {Bacillus cereus [TaxId: 1396]}
hmasreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfk
kyglanelpnfleknq

SCOPe Domain Coordinates for d2jj7b1:

Click to download the PDB-style file with coordinates for d2jj7b1.
(The format of our PDB-style files is described here.)

Timeline for d2jj7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jj7b2