SCOPe 2.08: Domain d2jj7a2: 2jj7 A:77-183

Lineage for d2jj7a2 (2jj7 A:77-183)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (6 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries)

8. Domain d2jj7a2: 2jj7 A:77-183 [230965]
   Other proteins in same PDB: d2jj7a1, d2jj7b1
   automated match to d2fx0a2
   mutant

Details for d2jj7a2

PDB Entry: 2jj7, 2.1 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 170-185 substituted by alanine

PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2jj7a2:

Sequence, based on SEQRES records:

>d2jj7a2 a.121.1.1 (A:77-183) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidsadlvsriisaltdk

Sequence, based on observed residues (ATOM records):

>d2jj7a2 a.121.1.1 (A:77-183) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfdsadlvsriisaltdk

Timeline for d2jj7a2:

• d2jj7a2 first appeared in SCOPe 2.03
  
• d2jj7a2 appears in SCOPe 2.07