Lineage for d1rkrc_ (1rkr C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (3 PDB entries) 
Domain d1rkrc_: 1rkr C: [22921]
Details for d1rkrc_
PDB Entry: 1rkr (more details), 2.45 Å
PDB Description: crystal structure of azurin-i from alcaligenes xylosoxidans ncimb 11015
SCOP Domain Sequences for d1rkrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkrc_ b.6.1.1 (C:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms}
aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
mkgvlklvd
SCOP Domain Coordinates for d1rkrc_:
Click to download the PDB-style file with coordinates for d1rkrc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rkrc_:
- d1rkrc_ appears in SCOP 1.57
- d1rkrc_ appears in the current release, SCOPe 2.08
View in 3D
