Lineage for d1rkrc_ (1rkr C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 55952Protein Azurin [49530] (6 species)
  7. 55972Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (3 PDB entries)
  8. 55977Domain d1rkrc_: 1rkr C: [22921]

Details for d1rkrc_

PDB Entry: 1rkr (more details), 2.45 Å

PDB Description: crystal structure of azurin-i from alcaligenes xylosoxidans ncimb 11015

SCOP Domain Sequences for d1rkrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkrc_ b.6.1.1 (C:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms}
aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
mkgvlklvd

SCOP Domain Coordinates for d1rkrc_:

Click to download the PDB-style file with coordinates for d1rkrc_.
(The format of our PDB-style files is described here.)

Timeline for d1rkrc_: