Lineage for d1rkrc_ (1rkr C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770498Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries)
  8. 2770504Domain d1rkrc_: 1rkr C: [22921]
    complexed with cu

Details for d1rkrc_

PDB Entry: 1rkr (more details), 2.45 Å

PDB Description: crystal structure of azurin-i from alcaligenes xylosoxidans ncimb 11015
PDB Compounds: (C:) azurin-I

SCOPe Domain Sequences for d1rkrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkrc_ b.6.1.1 (C:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}
aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
mkgvlklvd

SCOPe Domain Coordinates for d1rkrc_:

Click to download the PDB-style file with coordinates for d1rkrc_.
(The format of our PDB-style files is described here.)

Timeline for d1rkrc_: