Lineage for d1rkra_ (1rkr A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 10937Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (3 PDB entries)
  8. 10940Domain d1rkra_: 1rkr A: [22919]

Details for d1rkra_

PDB Entry: 1rkr (more details), 2.45 Å

PDB Description: crystal structure of azurin-i from alcaligenes xylosoxidans ncimb 11015

SCOP Domain Sequences for d1rkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkra_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms}
aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
mkgvlklvd

SCOP Domain Coordinates for d1rkra_:

Click to download the PDB-style file with coordinates for d1rkra_.
(The format of our PDB-style files is described here.)

Timeline for d1rkra_: