Lineage for d1c3ga2 (1c3g A:260-349)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (1 family) 
Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (1 protein) Protein Heat shock protein 40 Sis1 [49495] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (1 PDB entry) 
Domain d1c3ga2: 1c3g A:260-349 [22832]
Details for d1c3ga2
PDB Entry: 1c3g (more details), 2.7 Å
PDB Description: s. cerevisiae heat shock protein 40 sis1
SCOP Domain Sequences for d1c3ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae)}
nfkrdgddliytlplsfkesllgfsktiqtidgrtlplsrvqpvqpsqtstypgqgmptp
knpsqrgnlivkykvdypislndaqkraid
SCOP Domain Coordinates for d1c3ga2:
Click to download the PDB-style file with coordinates for d1c3ga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c3ga2:
- d1c3ga2 appears in SCOP 1.57
- d1c3ga2 appears in the current release, SCOPe 2.08
View in 3D
