SCOPe 2.08: Domain d1c3ga2: 1c3g A:260-349

Lineage for d1c3ga2 (1c3g A:260-349)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins)

6. Protein Heat shock protein 40 Sis1 [49495] (1 species)
   duplication: contains two domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (2 PDB entries)

8. Domain d1c3ga2: 1c3g A:260-349 [22832]

Details for d1c3ga2

PDB Entry: 1c3g, 2.7 Å

PDB Description: s. cerevisiae heat shock protein 40 sis1

PDB Compounds: (A:) heat shock protein 40

SCOPe Domain Sequences for d1c3ga2:

Sequence; same for both SEQRES and ATOM records:

>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nfkrdgddliytlplsfkesllgfsktiqtidgrtlplsrvqpvqpsqtstypgqgmptp
knpsqrgnlivkykvdypislndaqkraid

Timeline for d1c3ga2:

• d1c3ga2 first appeared (with stable ids) in SCOP 1.55
  
• d1c3ga2 appears in SCOPe 2.07