| Class b: All beta proteins [48724] (180 folds) |
| Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) ![]() |
| Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins) |
| Protein Heat shock protein 40 Sis1 [49495] (1 species) duplication: contains two domains of this fold |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (2 PDB entries) |
| Domain d1c3ga1: 1c3g A:180-259 [22831] |
PDB Entry: 1c3g (more details), 2.7 Å
SCOPe Domain Sequences for d1c3ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
npqtgrrktlqfviqekshp
Timeline for d1c3ga1: