PDB entry 1c3g

View 1c3g on RCSB PDB site
Description: s. cerevisiae heat shock protein 40 sis1
Class: chaperone
Keywords: beta sheets, short helices, chaperone
Deposited on 1999-07-27, released 2000-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein 40
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c3ga1, d1c3ga2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c3gA (A:)
etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
npqtgrrktlqfviqekshpnfkrdgddliytlplsfkesllgfsktiqtidgrtlplsr
vqpvqpsqtstypgqgmptpknpsqrgnlivkykvdypislndaqkraid