Lineage for d1c3ga1 (1c3g A:180-259)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10887Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
  4. 10888Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (1 family) (S)
  5. 10889Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (1 protein)
  6. 10890Protein Heat shock protein 40 Sis1 [49495] (1 species)
  7. 10891Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (1 PDB entry)
  8. 10892Domain d1c3ga1: 1c3g A:180-259 [22831]

Details for d1c3ga1

PDB Entry: 1c3g (more details), 2.7 Å

PDB Description: s. cerevisiae heat shock protein 40 sis1

SCOP Domain Sequences for d1c3ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae)}
etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
npqtgrrktlqfviqekshp

SCOP Domain Coordinates for d1c3ga1:

Click to download the PDB-style file with coordinates for d1c3ga1.
(The format of our PDB-style files is described here.)

Timeline for d1c3ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c3ga2