PDB entry 1c3g

View 1c3g on RCSB PDB site
Description: s. cerevisiae heat shock protein 40 sis1
Deposited on 1999-07-27, released 2000-08-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-03, with a file datestamp of 2000-08-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.265
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3gA (A:)
    etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
    npqtgrrktlqfviqekshpnfkrdgddliytlplsfkesllgfsktiqtidgrtlplsr
    vqpvqpsqtstypgqgmptpknpsqrgnlivkykvdypislndaqkraid