![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
![]() | Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
![]() | Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species) |
![]() | Species Salmonella enterica [TaxId:90371] [227351] (2 PDB entries) |
![]() | Domain d3ugja3: 3ugj A:221-429 [227361] Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja4, d3ugja6, d3ugja7, d3ugja8 automated match to d1t3ta4 complexed with adp, mg, so4 |
PDB Entry: 3ugj (more details), 1.78 Å
SCOPe Domain Sequences for d3ugja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugja3 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella enterica [TaxId: 90371]} ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn geelrgyhkpimlaggigniradhvqkge
Timeline for d3ugja3: