SCOPe 2.08: Domain d3ugja4: 3ugj A:430-616

Lineage for d3ugja4 (3ugj A:430-616)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)

6. Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain [419050] (3 species)

7. Species Salmonella enterica [TaxId:90371] [419537] (2 PDB entries)

8. Domain d3ugja4: 3ugj A:430-616 [227362]
   Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja3, d3ugja5, d3ugja6, d3ugja7, d3ugja8
   automated match to d1t3ta6
   complexed with adp, mg, so4
   missing some secondary structures that made up less than one-third of the common domain

Details for d3ugja4

PDB Entry: 3ugj, 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja4:

Sequence, based on SEQRES records:

>d3ugja4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella enterica [TaxId: 90371]}
ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw
qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe
ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt
pkmtrdv

Sequence, based on observed residues (ATOM records):

>d3ugja4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella enterica [TaxId: 90371]}
ivvgaklivlggpamnigldfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgag
glsnampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdel
ckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv

Timeline for d3ugja4:

• d3ugja4 first appeared in SCOPe 2.03
  
• d3ugja4 appears in SCOPe 2.07