![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins) |
![]() | Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain [419050] (3 species) |
![]() | Species Salmonella enterica [TaxId:90371] [419537] (2 PDB entries) |
![]() | Domain d3ugja4: 3ugj A:430-616 [227362] Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja3, d3ugja5, d3ugja6, d3ugja7, d3ugja8 automated match to d1t3ta6 complexed with adp, mg, so4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3ugj (more details), 1.78 Å
SCOPe Domain Sequences for d3ugja4:
Sequence, based on SEQRES records: (download)
>d3ugja4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella enterica [TaxId: 90371]} ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt pkmtrdv
>d3ugja4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella enterica [TaxId: 90371]} ivvgaklivlggpamnigldfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgag glsnampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdel ckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv
Timeline for d3ugja4: