Lineage for d3ugja1 (3ugj A:1-152)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009677Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 3009678Superfamily d.284.1: PurS-like [82697] (3 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 3009696Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein)
    duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer
  6. 3009697Protein FGAM synthase PurL, PurS-like domain [111003] (3 species)
  7. 3009698Species Salmonella enterica [TaxId:90371] [227347] (2 PDB entries)
  8. 3009699Domain d3ugja1: 3ugj A:1-152 [227359]
    Other proteins in same PDB: d3ugja2, d3ugja3, d3ugja4, d3ugja5, d3ugja6, d3ugja7, d3ugja8
    automated match to d1t3ta3
    complexed with adp, mg, so4

Details for d3ugja1

PDB Entry: 3ugj (more details), 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugja1 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella enterica [TaxId: 90371]}
mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq
ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt
aeqwrqvaaelhdrmmetvfssltdaeklfih

SCOPe Domain Coordinates for d3ugja1:

Click to download the PDB-style file with coordinates for d3ugja1.
(The format of our PDB-style files is described here.)

Timeline for d3ugja1: