SCOPe 2.08: Domain d3ugja7: 3ugj A:1034-1295

Lineage for d3ugja7 (3ugj A:1034-1295)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein FGAM synthase PurL, amidotransferase domain [110484] (3 species)

7. Species Salmonella enterica [TaxId:90371] [227357] (2 PDB entries)

8. Domain d3ugja7: 3ugj A:1034-1295 [227365]
   Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja3, d3ugja4, d3ugja5, d3ugja6, d3ugja8
   automated match to d1t3ta2
   complexed with adp, mg, so4

Details for d3ugja7

PDB Entry: 3ugj, 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja7:

Sequence; same for both SEQRES and ATOM records:

>d3ugja7 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella enterica [TaxId: 90371]}
iatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvacgg
fsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgsel
wprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaale
skglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvanswh
penwgedspwmrifrnarkqlg

Timeline for d3ugja7:

• d3ugja7 first appeared in SCOPe 2.03
  
• d3ugja7 appears in SCOPe 2.07