Lineage for d3ugja2 (3ugj A:153-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696341Superfamily a.5.10: FGAM synthase PurL, linker domain [109736] (1 family) (S)
  5. 2696342Family a.5.10.1: FGAM synthase PurL, linker domain [109737] (1 protein)
  6. 2696343Protein FGAM synthase PurL, linker domain [109738] (3 species)
  7. 2696344Species Salmonella enterica [TaxId:90371] [227349] (2 PDB entries)
  8. 2696345Domain d3ugja2: 3ugj A:153-220 [227360]
    Other proteins in same PDB: d3ugja1, d3ugja3, d3ugja4, d3ugja5, d3ugja6, d3ugja7, d3ugja8
    automated match to d1t3ta1
    complexed with adp, mg, so4

Details for d3ugja2

PDB Entry: 3ugj (more details), 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugja2 a.5.10.1 (A:153-220) FGAM synthase PurL, linker domain {Salmonella enterica [TaxId: 90371]}
hqpapvssvdllgegrqalidanlrlglalaedeidylqeaftklgrnpndielymfaqa
nsehcrhk

SCOPe Domain Coordinates for d3ugja2:

Click to download the PDB-style file with coordinates for d3ugja2.
(The format of our PDB-style files is described here.)

Timeline for d3ugja2: