Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins) |
Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain [419050] (3 species) |
Species Salmonella typhimurium [TaxId:90371] [419539] (1 PDB entry) Uniprot P74881 |
Domain d1t3ta6: 1t3t A:430-616 [106386] Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta7, d1t3ta8 complexed with adp, mg, so4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1t3t (more details), 1.9 Å
SCOPe Domain Sequences for d1t3ta6:
Sequence, based on SEQRES records: (download)
>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt pkmtrdv
>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv
Timeline for d1t3ta6: