Lineage for d1t3ta6 (1t3t A:430-616)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978160Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain [419050] (3 species)
  7. 2978164Species Salmonella typhimurium [TaxId:90371] [419539] (1 PDB entry)
    Uniprot P74881
  8. 2978165Domain d1t3ta6: 1t3t A:430-616 [106386]
    Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta7, d1t3ta8
    complexed with adp, mg, so4
    missing some secondary structures that made up less than one-third of the common domain

Details for d1t3ta6

PDB Entry: 1t3t (more details), 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d1t3ta6:

Sequence, based on SEQRES records: (download)

>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw
qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe
ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt
pkmtrdv

Sequence, based on observed residues (ATOM records): (download)

>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl
snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck
rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv

SCOPe Domain Coordinates for d1t3ta6:

Click to download the PDB-style file with coordinates for d1t3ta6.
(The format of our PDB-style files is described here.)

Timeline for d1t3ta6: