Lineage for d1t3ta5 (1t3t A:617-816)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960238Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2960239Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2960258Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)
  7. 2960264Species Salmonella typhimurium [TaxId:90371] [111036] (1 PDB entry)
    Uniprot P74881
  8. 2960266Domain d1t3ta5: 1t3t A:617-816 [106385]
    Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta6, d1t3ta7, d1t3ta8
    complexed with adp, mg, so4

Details for d1t3ta5

PDB Entry: 1t3t (more details), 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d1t3ta5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ta5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 90371]}
qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp
vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl
sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneqremts
plslvisafarvedvrhtlt

SCOPe Domain Coordinates for d1t3ta5:

Click to download the PDB-style file with coordinates for d1t3ta5.
(The format of our PDB-style files is described here.)

Timeline for d1t3ta5: