Lineage for d1t3ta1 (1t3t A:153-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696341Superfamily a.5.10: FGAM synthase PurL, linker domain [109736] (1 family) (S)
  5. 2696342Family a.5.10.1: FGAM synthase PurL, linker domain [109737] (1 protein)
  6. 2696343Protein FGAM synthase PurL, linker domain [109738] (3 species)
  7. 2696347Species Salmonella typhimurium [TaxId:90371] [109739] (1 PDB entry)
    Uniprot P74881
  8. 2696348Domain d1t3ta1: 1t3t A:153-220 [106381]
    Other proteins in same PDB: d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7, d1t3ta8
    complexed with adp, mg, so4

Details for d1t3ta1

PDB Entry: 1t3t (more details), 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d1t3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ta1 a.5.10.1 (A:153-220) FGAM synthase PurL, linker domain {Salmonella typhimurium [TaxId: 90371]}
hqpapvssvdllgegrqalidanlrlglalaedeidylqeaftklgrnpndielymfaqa
nsehcrhk

SCOPe Domain Coordinates for d1t3ta1:

Click to download the PDB-style file with coordinates for d1t3ta1.
(The format of our PDB-style files is described here.)

Timeline for d1t3ta1: