SCOPe 2.08: Domain d1t3ta3: 1t3t A:1-152

Lineage for d1t3ta3 (1t3t A:1-152)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.284: PurS-like [109622] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.284.1: PurS-like [82697] (3 families)
   segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit

5. Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein)
   duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer

6. Protein FGAM synthase PurL, PurS-like domain [111003] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [111004] (1 PDB entry)
   Uniprot P74881

8. Domain d1t3ta3: 1t3t A:1-152 [106383]
   Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7, d1t3ta8
   complexed with adp, mg, so4

Details for d1t3ta3

PDB Entry: 1t3t, 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d1t3ta3:

Sequence; same for both SEQRES and ATOM records:

>d1t3ta3 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella typhimurium [TaxId: 90371]}
mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq
ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt
aeqwrqvaaelhdrmmetvfssltdaeklfih

Timeline for d1t3ta3:

• d1t3ta3 first appeared in SCOP 1.69
  
• d1t3ta3 appears in SCOPe 2.07