Lineage for d1t3ta6 (1t3t A:430-616)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511592Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 511593Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 511594Family d.139.1.1: PurM C-terminal domain-like [56043] (3 proteins)
  6. 511601Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (1 species)
  7. 511602Species Salmonella typhimurium [TaxId:90371] [111182] (1 PDB entry)
  8. 511603Domain d1t3ta6: 1t3t A:430-616 [106386]
    Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5

Details for d1t3ta6

PDB Entry: 1t3t (more details), 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase

SCOP Domain Sequences for d1t3ta6:

Sequence, based on SEQRES records: (download)

>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium}
ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw
qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe
ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt
pkmtrdv

Sequence, based on observed residues (ATOM records): (download)

>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium}
ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl
snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck
rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv

SCOP Domain Coordinates for d1t3ta6:

Click to download the PDB-style file with coordinates for d1t3ta6.
(The format of our PDB-style files is described here.)

Timeline for d1t3ta6: