![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (3 proteins) |
![]() | Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [111182] (1 PDB entry) |
![]() | Domain d1t3ta6: 1t3t A:430-616 [106386] Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5 |
PDB Entry: 1t3t (more details), 1.9 Å
SCOP Domain Sequences for d1t3ta6:
Sequence, based on SEQRES records: (download)
>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium} ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt pkmtrdv
>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium} ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv
Timeline for d1t3ta6: