PDB entry 1t3t

View 1t3t on RCSB PDB site
Description: Structure of Formylglycinamide synthetase
Class: ligase
Keywords: PurL, FGAM synthetase, PurS, PurQ, formyl glycinamide, LIGASE
Deposited on 2004-04-27, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylformylglycinamidine synthase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: PURL, STM2565
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74881 (8-1302)
      • cloning artifact (0-7)
      • modified residue (1142)
    Domains in SCOPe 2.07: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7, d1t3ta8
  • Heterogens: MG, SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3tA (A:)
    glvprgshmmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseq
    aqltrllqygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvay
    yieastltaeqwrqvaaelhdrmmetvfssltdaeklfihhqpapvssvdllgegrqali
    danlrlglalaedeidylqeaftklgrnpndielymfaqansehcrhkifnadwiidgkp
    qpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgrydfhqepahilmk
    vethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnlripgfeqpweed
    fgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshngeelrgyhkpim
    laggigniradhvqkgeivvgaklivlggpamniglgggaassmasgqsdadldfasvqr
    dnpemerrcqevidrcwqlgdanpilfihdvgagglsnampelvsdggrggkfelrdils
    depgmspleiwcnesqeryvlavaadqlplfdelckrerapyavigdateeqhlslhdnh
    fdnqpidlpldvllgktpkmtrdvqtlkakgdalnraditiadavkrvlhlptvaektfl
    vtigdrtvtgmvardqmvgpwqvpvadcavttasldsyygeamsigerapvalldfaasa
    rlavgealtniaatqigdikriklsanwmaaaghpgedaglydavkavgeelcpqlglti
    pvgkdsmsmktrwqegneqremtsplslvisafarvedvrhtltpqlstednalllidlg
    kghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaarkllawhdrsdggllv
    tlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedrdaveallaqygladcv
    hylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlrdnpqcadqeheakand
    tdpglnvklsfdinediaapyiatgarpkvavlreqgvnshvemaaafhragfdaidvhm
    sdllggriglgnfhalvacggfsygdvlgagegwaksilfnhrvrdefetffhrpqtlal
    gvcngcqmmsnlrelipgselwprfvrnhsdrfearfslvevtqspslllqgmvgsqmpi
    avshgegrvevrddahlaaleskglvalryvdnfgkvtetypanpngspngitavtteng
    rvtimmphpervfrtvanswhpenwgedspwmrifrnarkqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3tA (A:)
    glvprgshmmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseq
    aqltrllqygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvay
    yieastltaeqwrqvaaelhdrmmetvfssltdaeklfihhqpapvssvdllgegrqali
    danlrlglalaedeidylqeaftklgrnpndielymfaqansehcrhkifnadwiidgkp
    qpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgrydfhqepahilmk
    vethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnlripgfeqpweed
    fgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshngeelrgyhkpim
    laggigniradhvqkgeivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwql
    gdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqery
    vlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpk
    mtrdvqtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvg
    pwqvpvadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdi
    kriklsanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneq
    remtsplslvisafarvedvrhtltpqlstednalllidlgkghnalgatalaqvyrqlg
    dkpadvrdvaqlkgfydamqalvaarkllawhdrsdggllvtlaemafaghcgvqvdiaa
    lgddhlaalfneelggviqvraedrdaveallaqygladcvhylgqalagdrfvitandq
    tvfsesrttlrvwwaettwqmqrlrdnpqcadqeheakandtdpglnvklsfdinediaa
    pyiatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvac
    ggfsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgs
    elwprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaa
    leskglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvans
    whpenwgedspwmrifrnarkqlg