Lineage for d3ugja3 (3ugj A:221-429)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1421161Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1421162Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1421172Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)
  7. 1421173Species Salmonella enterica [TaxId:90371] [227351] (2 PDB entries)
  8. 1421174Domain d3ugja3: 3ugj A:221-429 [227361]
    Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja4, d3ugja6, d3ugja7
    automated match to d1t3ta4
    complexed with adp, mg, so4

Details for d3ugja3

PDB Entry: 3ugj (more details), 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugja3 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella enterica [TaxId: 90371]}
ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry
dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl
ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn
geelrgyhkpimlaggigniradhvqkge

SCOPe Domain Coordinates for d3ugja3:

Click to download the PDB-style file with coordinates for d3ugja3.
(The format of our PDB-style files is described here.)

Timeline for d3ugja3: