| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
| Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species) |
| Species Salmonella typhimurium [TaxId:90371] [111036] (1 PDB entry) Uniprot P74881 |
| Domain d1t3ta4: 1t3t A:221-429 [106384] Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta6, d1t3ta7 complexed with adp, mg, so4 |
PDB Entry: 1t3t (more details), 1.9 Å
SCOPe Domain Sequences for d1t3ta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ta4 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 90371]}
ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry
dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl
ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn
geelrgyhkpimlaggigniradhvqkge
Timeline for d1t3ta4: