SCOP 1.69: Domain d1t3ta4: 1t3t A:221-429

Lineage for d1t3ta4 (1t3t A:221-429)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (3 proteins)

6. Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [111036] (1 PDB entry)

8. Domain d1t3ta4: 1t3t A:221-429 [106384]
   Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta6, d1t3ta7

Details for d1t3ta4

PDB Entry: 1t3t, 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase

SCOP Domain Sequences for d1t3ta4:

Sequence; same for both SEQRES and ATOM records:

>d1t3ta4 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium}
ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry
dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl
ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn
geelrgyhkpimlaggigniradhvqkge

Timeline for d1t3ta4:

• d1t3ta4 is new in SCOP 1.69
  
• d1t3ta4 appears in SCOP 1.71
  
• d1t3ta4 appears in the current release, SCOPe 2.08