| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein FGAM synthase PurL, amidotransferase domain [110484] (3 species) |
| Species Salmonella enterica [TaxId:90371] [227357] (2 PDB entries) |
| Domain d3ugja7: 3ugj A:1034-1295 [227365] Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja3, d3ugja4, d3ugja5, d3ugja6 automated match to d1t3ta2 complexed with adp, mg, so4 |
PDB Entry: 3ugj (more details), 1.78 Å
SCOPe Domain Sequences for d3ugja7:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugja7 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella enterica [TaxId: 90371]}
iatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvacgg
fsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgsel
wprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaale
skglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvanswh
penwgedspwmrifrnarkqlg
Timeline for d3ugja7: