PDB entry 3ugj

View 3ugj on RCSB PDB site
Description: Formyl Glycinamide ribonucletide amidotransferase from Salmonella Typhimurum: Role of the ATP complexation and glutaminase domain in catalytic coupling
Class: ligase
Keywords: Amidotransferase, Glutaminase, Thioester intermediate, LIGASE
Deposited on 2011-11-02, released 2012-06-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.211
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylformylglycinamidine synthase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74881 (8-1302)
      • expression tag (0-7)
    Domains in SCOPe 2.03: d3ugja1, d3ugja2, d3ugja3, d3ugja4, d3ugja5, d3ugja6, d3ugja7
  • Heterogens: SO4, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ugjA (A:)
    glvprgshmmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseq
    aqltrllqygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvay
    yieastltaeqwrqvaaelhdrmmetvfssltdaeklfihhqpapvssvdllgegrqali
    danlrlglalaedeidylqeaftklgrnpndielymfaqansehcrhkifnadwiidgkp
    qpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgrydfhqepahilmk
    vethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnlripgfeqpweed
    fgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshngeelrgyhkpim
    laggigniradhvqkgeivvgaklivlggpamniglgggaassmasgqsdadldfasvqr
    dnpemerrcqevidrcwqlgdanpilfihdvgagglsnampelvsdggrggkfelrdils
    depgmspleiwcnesqeryvlavaadqlplfdelckrerapyavigdateeqhlslhdnh
    fdnqpidlpldvllgktpkmtrdvqtlkakgdalnraditiadavkrvlhlptvaektfl
    vtigdrtvtgmvardqmvgpwqvpvadcavttasldsyygeamsigerapvalldfaasa
    rlavgealtniaatqigdikriklsanwmaaaghpgedaglydavkavgeelcpqlglti
    pvgkdsmsmktrwqegneqremtsplslvisafarvedvrhtltpqlstednalllidlg
    kghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaarkllawhdrsdggllv
    tlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedrdaveallaqygladcv
    hylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlrdnpqcadqeheakand
    tdpglnvklsfdinediaapyiatgarpkvavlreqgvnshvemaaafhragfdaidvhm
    sdllggriglgnfhalvacggfsygdvlgagegwaksilfnhrvrdefetffhrpqtlal
    gvcngcqmmsnlrelipgselwprfvrnhsdrfearfslvevtqspslllqgmvgsqmpi
    avshgegrvevrddahlaaleskglvalryvdnfgkvtetypanpngspngitavtteng
    rvtimmphpervfrtvanswhpenwgedspwmrifrnarkqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ugjA (A:)
    glvprgshmmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseq
    aqltrllqygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvay
    yieastltaeqwrqvaaelhdrmmetvfssltdaeklfihhqpapvssvdllgegrqali
    danlrlglalaedeidylqeaftklgrnpndielymfaqansehcrhkifnadwiidgkp
    qpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgrydfhqepahilmk
    vethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnlripgfeqpweed
    fgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshngeelrgyhkpim
    laggigniradhvqkgeivvgaklivlggpamnigldfasvqrdnpemerrcqevidrcw
    qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe
    ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt
    pkmtrdvqtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqm
    vgpwqvpvadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqig
    dikriklsanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegq
    remtsplslvisafarvedvrhtltpqlstednalllidlgkghnalgatalaqvyrqlg
    dkpadvrdvaqlkgfydamqalvaarkllawhdrsdggllvtlaemafaghcgvqvdiaa
    lgddhlaalfneelggviqvraedrdaveallaqygladcvhylgqalagdrfvitandq
    tvfsesrttlrvwwaettwqmqrlrdnpqcadqeheakandtdpglnvklsfdinediaa
    pyiatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvac
    ggfsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgs
    elwprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaa
    leskglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvans
    whpenwgedspwmrifrnarkqlg